Lineage for d1ecgb2 (1ecg B:1-249)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species)
  7. Species Escherichia coli [TaxId:562] [56241] (5 PDB entries)
  8. Domain d1ecgb2: 1ecg B:1-249 [41823]
    Other proteins in same PDB: d1ecga1, d1ecgb1
    complexed with onl, pin

Details for d1ecgb2

PDB Entry: 1ecg (more details), 2.3 Å

PDB Description: don inactivated escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase
PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecgb2 d.153.1.1 (B:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

SCOPe Domain Coordinates for d1ecgb2 are not available.

Timeline for d1ecgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ecgb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ecga1, d1ecga2