Lineage for d7kema2 (7kem A:252-407)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825385Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2825386Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2825387Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2825409Protein automated matches [234004] (6 species)
    not a true protein
  7. 2825441Species Mycobacterium tuberculosis [TaxId:83332] [419972] (10 PDB entries)
  8. 2825452Domain d7kema2: 7kem A:252-407 [418217]
    Other proteins in same PDB: d7kema1
    automated match to d3tura2
    complexed with 0jc, 6cl, dgl, pt

Details for d7kema2

PDB Entry: 7kem (more details), 1.77 Å

PDB Description: crystallographic structure of l,d-transpeptidase 2 from mycobacterium tuberculosis
PDB Compounds: (A:) L,D-transpeptidase 2

SCOPe Domain Sequences for d7kema2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kema2 b.160.1.1 (A:252-407) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eviataddntkiltvrvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvp
vnspngyrtdvdwatqisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkr
gdivevvntvggtlpgidglgdwnipwdqwragnak

SCOPe Domain Coordinates for d7kema2:

Click to download the PDB-style file with coordinates for d7kema2.
(The format of our PDB-style files is described here.)

Timeline for d7kema2:

  • d7kema2 is new in SCOPe 2.08-stable

2825452
d7kema2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7kema1