![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins) has slightly different topology than other families do |
![]() | Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [56241] (5 PDB entries) |
![]() | Domain d1ecfb2: 1ecf B:1-249 [41821] Other proteins in same PDB: d1ecfa1, d1ecfb1 complexed with pin |
PDB Entry: 1ecf (more details), 2 Å
SCOPe Domain Sequences for d1ecfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecfb2 d.153.1.1 (B:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli [TaxId: 562]} cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft rqcadnpvs
Timeline for d1ecfb2: