Lineage for d7jqke_ (7jqk E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798248Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries)
  8. 2798252Domain d7jqke_: 7jqk E: [418186]
    automated match to d6nvbb_
    complexed with 2pe, cd, cl; mutant

Details for d7jqke_

PDB Entry: 7jqk (more details), 1.33 Å

PDB Description: crystal structure of the r64a mutant of bauhinia bauhinioides kallikrein inhibitor complexed with human kallikrein 4
PDB Compounds: (E:) Kallikrein-4

SCOPe Domain Sequences for d7jqke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jqke_ b.47.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsleadq
epgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclv
sgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggp
licngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

SCOPe Domain Coordinates for d7jqke_:

Click to download the PDB-style file with coordinates for d7jqke_.
(The format of our PDB-style files is described here.)

Timeline for d7jqke_:

  • d7jqke_ is new in SCOPe 2.08-stable