Lineage for d7jfyb_ (7jfy B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773076Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)
  8. 2773090Domain d7jfyb_: 7jfy B: [418161]
    automated match to d3fk3a_
    complexed with dms, edo, v91

Details for d7jfyb_

PDB Entry: 7jfy (more details), 2.1 Å

PDB Description: gas41 yeats domain in complex with 5
PDB Compounds: (B:) YEATS domain-containing protein 4

SCOPe Domain Sequences for d7jfyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jfyb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tivkpivygnvaryfgkkreedghthqwtvyvkpyrnedmsayvkkiqfklhesygnplr
vvtkppyeitetgwgefeiiikiffidpnerpvtlyhllklfqsdtnamlgkktvvsefy
demif

SCOPe Domain Coordinates for d7jfyb_:

Click to download the PDB-style file with coordinates for d7jfyb_.
(The format of our PDB-style files is described here.)

Timeline for d7jfyb_:

  • d7jfyb_ is new in SCOPe 2.08-stable