Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries) |
Domain d7jfyb_: 7jfy B: [418161] automated match to d3fk3a_ complexed with dms, edo, v91 |
PDB Entry: 7jfy (more details), 2.1 Å
SCOPe Domain Sequences for d7jfyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jfyb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tivkpivygnvaryfgkkreedghthqwtvyvkpyrnedmsayvkkiqfklhesygnplr vvtkppyeitetgwgefeiiikiffidpnerpvtlyhllklfqsdtnamlgkktvvsefy demif
Timeline for d7jfyb_: