Lineage for d7f4gk_ (7f4g K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958305Family d.74.3.0: automated matches [254324] (1 protein)
    not a true family
  6. 2958306Protein automated matches [254742] (3 species)
    not a true protein
  7. 2958313Species Sus scrofa [TaxId:9825] [404454] (2 PDB entries)
  8. 2958315Domain d7f4gk_: 7f4g K: [418155]
    Other proteins in same PDB: d7f4gd_, d7f4gg1, d7f4gg2, d7f4gh_, d7f4gj_, d7f4gl_
    automated match to d7b7uk_
    complexed with zn

Details for d7f4gk_

PDB Entry: 7f4g (more details), 2.78 Å

PDB Description: structure of rpap2-bound rna polymerase ii
PDB Compounds: (K:) RNA_pol_L_2 domain-containing protein

SCOPe Domain Sequences for d7f4gk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7f4gk_ d.74.3.0 (K:) automated matches {Sus scrofa [TaxId: 9825]}
mnappafesfllfegekkitinkdtkvpnaclftinkedhtlgniiksqllkdpqvlfag
ykvphplehkiiirvqttpdyspqeaftnaitdliselslleerfrvaikdkqeg

SCOPe Domain Coordinates for d7f4gk_:

Click to download the PDB-style file with coordinates for d7f4gk_.
(The format of our PDB-style files is described here.)

Timeline for d7f4gk_:

  • d7f4gk_ is new in SCOPe 2.08-stable