Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.0: automated matches [254324] (1 protein) not a true family |
Protein automated matches [254742] (3 species) not a true protein |
Species Sus scrofa [TaxId:9825] [404454] (2 PDB entries) |
Domain d7f4gk_: 7f4g K: [418155] Other proteins in same PDB: d7f4gd_, d7f4gg1, d7f4gg2, d7f4gh_, d7f4gj_, d7f4gl_ automated match to d7b7uk_ complexed with zn |
PDB Entry: 7f4g (more details), 2.78 Å
SCOPe Domain Sequences for d7f4gk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7f4gk_ d.74.3.0 (K:) automated matches {Sus scrofa [TaxId: 9825]} mnappafesfllfegekkitinkdtkvpnaclftinkedhtlgniiksqllkdpqvlfag ykvphplehkiiirvqttpdyspqeaftnaitdliselslleerfrvaikdkqeg
Timeline for d7f4gk_: