SCOPe 2.08: Domain d7f3od1: 7f3o D:413-795

Lineage for d7f3od1 (7f3o D:413-795)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189807] (8 PDB entries)

8. Domain d7f3od1: 7f3o D:413-795 [418144]
   Other proteins in same PDB: d7f3oa2, d7f3ob2, d7f3oc2, d7f3od2, d7f3oe2, d7f3of2
   automated match to d5ybge_
   complexed with 0yk, act, glu, gol, zn

Details for d7f3od1

PDB Entry: 7f3o, 1.44 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and tak- 653

PDB Compounds: (D:) Glutamate receptor 2

SCOPe Domain Sequences for d7f3od1:

Sequence; same for both SEQRES and ATOM records:

>d7f3od1 c.94.1.1 (D:413-795) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

Timeline for d7f3od1:

• d7f3od1 is new in SCOPe 2.08-stable