Lineage for d7f3ob1 (7f3o B:413-795)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913864Species Human (Homo sapiens) [TaxId:9606] [189807] (8 PDB entries)
  8. 2913866Domain d7f3ob1: 7f3o B:413-795 [418140]
    Other proteins in same PDB: d7f3oa2, d7f3ob2, d7f3oc2, d7f3od2, d7f3oe2, d7f3of2
    automated match to d5ybge_
    complexed with 0yk, act, glu, gol, zn

Details for d7f3ob1

PDB Entry: 7f3o (more details), 1.44 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and tak- 653
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d7f3ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7f3ob1 c.94.1.1 (B:413-795) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d7f3ob1:

Click to download the PDB-style file with coordinates for d7f3ob1.
(The format of our PDB-style files is described here.)

Timeline for d7f3ob1:

  • d7f3ob1 is new in SCOPe 2.08-stable