Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (2 species) |
Species Bacillus subtilis [TaxId:1423] [56240] (2 PDB entries) |
Domain d1gph22: 1gph 2:1-234 [41813] Other proteins in same PDB: d1gph11, d1gph21, d1gph31, d1gph41 complexed with amp, sf4 |
PDB Entry: 1gph (more details), 3 Å
SCOPe Domain Sequences for d1gph22:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gph22 d.153.1.1 (2:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis [TaxId: 1423]} cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs
Timeline for d1gph22: