Lineage for d1gdoc_ (1gdo C:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) 
Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins) Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species) Species Escherichia coli [TaxId:562] [56238] (2 PDB entries) 
Domain d1gdoc_: 1gdo C: [41806]
Details for d1gdoc_
PDB Entry: 1gdo (more details), 1.8 Å
PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate
SCOP Domain Sequences for d1gdoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdoc_ d.153.1.1 (C:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl
SCOP Domain Coordinates for d1gdoc_:
Click to download the PDB-style file with coordinates for d1gdoc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gdoc_:
- d1gdoc_ first appeared (with stable ids) in SCOP 1.55
- d1gdoc_ appears in SCOP 1.59
- d1gdoc_ last appears in SCOP 1.67
View in 3D
