SCOPe 2.08: Domain d7e5wa2: 7e5w A:61-329

Lineage for d7e5wa2 (7e5w A:61-329)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [420119] (1 PDB entry)

8. Domain d7e5wa2: 7e5w A:61-329 [418047]
   Other proteins in same PDB: d7e5wa1, d7e5wb1, d7e5wc1
   automated match to d2hsga2
   complexed with so4

Details for d7e5wa2

PDB Entry: 7e5w, 2.55 Å

PDB Description: the structure of ccpa from staphylococcus aureus

PDB Compounds: (A:) Catabolite control protein A

SCOPe Domain Sequences for d7e5wa2:

Sequence; same for both SEQRES and ATOM records:

>d7e5wa2 c.93.1.0 (A:61-329) automated matches {Staphylococcus aureus [TaxId: 158879]}
ttvgviipdisniyysqlarglediatmykyhsiisnsdndpekekeifnnllskqvdgi
iflggtiteemkelinqssvpvvvsgtngkdahiasvnidfteaakeitgeliekgaksf
alvggehskkaqedvlegltevlnknglqlgdtlncsgaesykegvkafakmkgnlpdai
lcisdeeaigimhsamdagikvpeelqiisfnntrlvemvrpqlssviqplydigavgmr
lltkymndekieepnvvlphrieyrgttk

Timeline for d7e5wa2:

• d7e5wa2 is new in SCOPe 2.08-stable