Lineage for d1b4nc2 (1b4n C:1-210)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily) Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) 
Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins) Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species) Species Archaeon Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries) 
Domain d1b4nc2: 1b4n C:1-210 [41802]
Other proteins in same PDB: d1b4na1, d1b4nb1, d1b4nc1, d1b4nd1
Details for d1b4nc2
PDB Entry: 1b4n (more details), 2.4 Å
PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate
SCOP Domain Sequences for d1b4nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4nc2 d.152.1.1 (C:1-210) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus}
mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
aagrpgmgavmgskklkavvirgtkeipva
SCOP Domain Coordinates for d1b4nc2:
Click to download the PDB-style file with coordinates for d1b4nc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b4nc2:
View in 3D
