Lineage for d1b4nb2 (1b4n B:1-210)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594563Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
    contains sandwich; duplication of alpha+beta motif with single mixed sheet
    motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel
  4. 2594564Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) (S)
    automatically mapped to Pfam PF02730
  5. 2594565Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)
  6. 2594570Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species)
  7. 2594571Species Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries)
  8. 2594577Domain d1b4nb2: 1b4n B:1-210 [41801]
    Other proteins in same PDB: d1b4na1, d1b4nb1, d1b4nc1, d1b4nd1
    complexed with ca, gua, pte, sf4

Details for d1b4nb2

PDB Entry: 1b4n (more details), 2.4 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate
PDB Compounds: (B:) formaldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1b4nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4nb2 d.152.1.1 (B:1-210) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
aagrpgmgavmgskklkavvirgtkeipva

SCOPe Domain Coordinates for d1b4nb2:

Click to download the PDB-style file with coordinates for d1b4nb2.
(The format of our PDB-style files is described here.)

Timeline for d1b4nb2: