Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily) contains sandwich; duplication of alpha+beta motif with single mixed sheet motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel |
Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) automatically mapped to Pfam PF02730 |
Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins) |
Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries) |
Domain d1b4nb2: 1b4n B:1-210 [41801] Other proteins in same PDB: d1b4na1, d1b4nb1, d1b4nc1, d1b4nd1 complexed with ca, gua, pte, sf4 |
PDB Entry: 1b4n (more details), 2.4 Å
SCOPe Domain Sequences for d1b4nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4nb2 d.152.1.1 (B:1-210) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]} mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr aagrpgmgavmgskklkavvirgtkeipva
Timeline for d1b4nb2: