Lineage for d7dcuc_ (7dcu C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694784Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)
  8. 2694796Domain d7dcuc_: 7dcu C: [417973]
    Other proteins in same PDB: d7dcua2
    automated match to d1hksa_
    protein/DNA complex; complexed with na

Details for d7dcuc_

PDB Entry: 7dcu (more details), 1.75 Å

PDB Description: crystal structure of hsf2 dna-binding domain in complex with 3-site hse dna (21 bp)
PDB Compounds: (C:) Heat shock factor protein 2

SCOPe Domain Sequences for d7dcuc_:

Sequence, based on SEQRES records: (download)

>d7dcuc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkv

Sequence, based on observed residues (ATOM records): (download)

>d7dcuc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvpvefqhpyfkqgqddllenikrkv

SCOPe Domain Coordinates for d7dcuc_:

Click to download the PDB-style file with coordinates for d7dcuc_.
(The format of our PDB-style files is described here.)

Timeline for d7dcuc_:

  • d7dcuc_ is new in SCOPe 2.08-stable