Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries) |
Domain d7dcuc_: 7dcu C: [417973] Other proteins in same PDB: d7dcua2 automated match to d1hksa_ protein/DNA complex; complexed with na |
PDB Entry: 7dcu (more details), 1.75 Å
SCOPe Domain Sequences for d7dcuc_:
Sequence, based on SEQRES records: (download)
>d7dcuc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkv
>d7dcuc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln mygfrkvvpvefqhpyfkqgqddllenikrkv
Timeline for d7dcuc_: