Lineage for d7dcte_ (7dct E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693501Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
    automatically mapped to Pfam PF00447
  6. 2693521Protein automated matches [254598] (1 species)
    not a true protein
  7. 2693522Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries)
  8. 2693535Domain d7dcte_: 7dct E: [417967]
    Other proteins in same PDB: d7dcta2, d7dctb2, d7dctc2, d7dctd2, d7dctf2
    automated match to d1hksa_
    protein/DNA complex; complexed with na

Details for d7dcte_

PDB Entry: 7dct (more details), 2.36 Å

PDB Description: crystal structure of hsf1 dna-binding domain in complex with 3-site hse dna (24 bp)
PDB Compounds: (E:) Heat shock factor protein 1

SCOPe Domain Sequences for d7dcte_:

Sequence, based on SEQRES records: (download)

>d7dcte_ a.4.5.22 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkv

Sequence, based on observed residues (ATOM records): (download)

>d7dcte_ a.4.5.22 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkpddtefqhpcflrgqeqllenikrkv

SCOPe Domain Coordinates for d7dcte_:

Click to download the PDB-style file with coordinates for d7dcte_.
(The format of our PDB-style files is described here.)

Timeline for d7dcte_:

  • d7dcte_ is new in SCOPe 2.08-stable