SCOPe 2.08: Domain d7dctd1: 7dct D:15-119

Lineage for d7dctd1 (7dct D:15-119)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein automated matches [254598] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries)

8. Domain d7dctd1: 7dct D:15-119 [417965]
   Other proteins in same PDB: d7dcta2, d7dctb2, d7dctc2, d7dctd2, d7dctf2
   automated match to d1hksa_
   protein/DNA complex; complexed with na

Details for d7dctd1

PDB Entry: 7dct, 2.36 Å

PDB Description: crystal structure of hsf1 dna-binding domain in complex with 3-site hse dna (24 bp)

PDB Compounds: (D:) Heat shock factor protein 1

SCOPe Domain Sequences for d7dctd1:

Sequence, based on SEQRES records:

>d7dctd1 a.4.5.22 (D:15-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkv

Sequence, based on observed residues (ATOM records):

>d7dctd1 a.4.5.22 (D:15-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhiddtefqhpcflrgqeqllenikrkv

Timeline for d7dctd1:

• d7dctd1 is new in SCOPe 2.08-stable