| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins) automatically mapped to Pfam PF00447 |
| Protein automated matches [254598] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries) |
| Domain d7dctc1: 7dct C:15-119 [417963] Other proteins in same PDB: d7dcta2, d7dctb2, d7dctc2, d7dctd2, d7dctf2 automated match to d1hksa_ protein/DNA complex; complexed with na |
PDB Entry: 7dct (more details), 2.36 Å
SCOPe Domain Sequences for d7dctc1:
Sequence, based on SEQRES records: (download)
>d7dctc1 a.4.5.22 (C:15-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkv
>d7dctc1 a.4.5.22 (C:15-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvddtefqhpcflrgqeqllenikrkv
Timeline for d7dctc1: