Lineage for d7dcsc1 (7dcs C:15-119)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693501Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
    automatically mapped to Pfam PF00447
  6. 2693521Protein automated matches [254598] (1 species)
    not a true protein
  7. 2693522Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries)
  8. 2693539Domain d7dcsc1: 7dcs C:15-119 [417953]
    Other proteins in same PDB: d7dcsa2, d7dcsb2, d7dcsc2, d7dcsd2
    automated match to d1hksa_
    protein/DNA complex; complexed with na

Details for d7dcsc1

PDB Entry: 7dcs (more details), 2.4 Å

PDB Description: crystal structure of hsf1 dna-binding domain in complex with 3-site hse dna (23 bp)
PDB Compounds: (C:) Heat shock factor protein 1

SCOPe Domain Sequences for d7dcsc1:

Sequence, based on SEQRES records: (download)

>d7dcsc1 a.4.5.22 (C:15-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkv

Sequence, based on observed residues (ATOM records): (download)

>d7dcsc1 a.4.5.22 (C:15-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhdtefqhpcflrgqeqllenikrkv

SCOPe Domain Coordinates for d7dcsc1:

Click to download the PDB-style file with coordinates for d7dcsc1.
(The format of our PDB-style files is described here.)

Timeline for d7dcsc1:

  • d7dcsc1 is new in SCOPe 2.08-stable