SCOP 1.57: Domain d1aorb2: 1aor B:1-210

Lineage for d1aorb2 (1aor B:1-210)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)

4. Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family)

5. Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)

6. Protein Aldehyde ferredoxin oxidoreductase [56230] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [56231] (1 PDB entry)

8. Domain d1aorb2: 1aor B:1-210 [41795]
   Other proteins in same PDB: d1aora1, d1aorb1

Details for d1aorb2

PDB Entry: 1aor, 2.3 Å

PDB Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase

SCOP Domain Sequences for d1aorb2:

Sequence; same for both SEQRES and ATOM records:

>d1aorb2 d.152.1.1 (B:1-210) Aldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus}
mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli
iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv
yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg
hraagrggvgavmgsknlkaiavegsktvp

Timeline for d1aorb2:

• d1aorb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aorb2 appears in SCOP 1.59
  
• d1aorb2 appears in the current release, SCOPe 2.08