Lineage for d1aorb2 (1aor B:1-210)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201107Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
    contains sandwich; duplication of alpha+beta motif with single mixed sheet
    motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel
  4. 2201108Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) (S)
    automatically mapped to Pfam PF02730
  5. 2201109Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 protein domains)
  6. 2201110Protein Aldehyde ferredoxin oxidoreductase [56230] (1 species)
  7. 2201111Species Pyrococcus furiosus [TaxId:2261] [56231] (1 PDB entry)
  8. 2201113Domain d1aorb2: 1aor B:1-210 [41795]
    Other proteins in same PDB: d1aora1, d1aorb1
    complexed with fe, na, pte, sf4

Details for d1aorb2

PDB Entry: 1aor (more details), 2.3 Å

PDB Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase
PDB Compounds: (B:) aldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1aorb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aorb2 d.152.1.1 (B:1-210) Aldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli
iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv
yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg
hraagrggvgavmgsknlkaiavegsktvp

SCOPe Domain Coordinates for d1aorb2:

Click to download the PDB-style file with coordinates for d1aorb2.
(The format of our PDB-style files is described here.)

Timeline for d1aorb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aorb1