![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily) contains sandwich; duplication of alpha+beta motif with single mixed sheet motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel |
![]() | Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) ![]() automatically mapped to Pfam PF02730 |
![]() | Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins) |
![]() | Protein Aldehyde ferredoxin oxidoreductase [56230] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [56231] (1 PDB entry) |
![]() | Domain d1aorb2: 1aor B:1-210 [41795] Other proteins in same PDB: d1aora1, d1aorb1 complexed with fe, na, pte, sf4 |
PDB Entry: 1aor (more details), 2.3 Å
SCOPe Domain Sequences for d1aorb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aorb2 d.152.1.1 (B:1-210) Aldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]} mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg hraagrggvgavmgsknlkaiavegsktvp
Timeline for d1aorb2: