![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins) automatically mapped to Pfam PF00447 |
![]() | Protein automated matches [254598] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries) |
![]() | Domain d7dcja_: 7dcj A: [417946] Other proteins in same PDB: d7dcjb2 automated match to d1hksa_ protein/DNA complex; complexed with na |
PDB Entry: 7dcj (more details), 2 Å
SCOPe Domain Sequences for d7dcja_:
Sequence, based on SEQRES records: (download)
>d7dcja_ a.4.5.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrk
>d7dcja_ a.4.5.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln mygfrkvverddtefqhpcflrgqeqllenikrk
Timeline for d7dcja_: