Lineage for d1aora2 (1aor A:1-210)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36585Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
  4. 36586Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) (S)
  5. 36587Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)
  6. 36588Protein Aldehyde ferredoxin oxidoreductase [56230] (1 species)
  7. 36589Species Pyrococcus furiosus [TaxId:186497] [56231] (1 PDB entry)
  8. 36590Domain d1aora2: 1aor A:1-210 [41794]
    Other proteins in same PDB: d1aora1, d1aorb1

Details for d1aora2

PDB Entry: 1aor (more details), 2.3 Å

PDB Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase

SCOP Domain Sequences for d1aora2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aora2 d.152.1.1 (A:1-210) Aldehyde ferredoxin oxidoreductase {Pyrococcus furiosus}
mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli
iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv
yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg
hraagrggvgavmgsknlkaiavegsktvp

SCOP Domain Coordinates for d1aora2:

Click to download the PDB-style file with coordinates for d1aora2.
(The format of our PDB-style files is described here.)

Timeline for d1aora2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aora1