Lineage for d1aora2 (1aor A:1-210)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
    contains sandwich; duplication of alpha+beta motif with single mixed sheet
    motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel
  4. Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) (S)
    automatically mapped to Pfam PF02730
  5. Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)
  6. Protein Aldehyde ferredoxin oxidoreductase [56230] (1 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [56231] (1 PDB entry)
  8. Domain d1aora2: 1aor A:1-210 [41794]
    Other proteins in same PDB: d1aora1, d1aorb1
    complexed with fe, na, pte, sf4

Details for d1aora2

PDB Entry: 1aor (more details), 2.3 Å

PDB Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase
PDB Compounds: (A:) aldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1aora2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aora2 d.152.1.1 (A:1-210) Aldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli
iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv
yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg
hraagrggvgavmgsknlkaiavegsktvp

SCOPe Domain Coordinates for d1aora2 are not available.

Timeline for d1aora2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aora1
View in 3D
Domains from other chains:
(mouse over for more information)
d1aorb1, d1aorb2