Lineage for d1atnd_ (1atn D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84756Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 84757Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 84758Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 84759Protein Deoxyribonuclease I [56225] (1 species)
  7. 84760Species Cow (Bos taurus) [TaxId:9913] [56226] (4 PDB entries)
  8. 84764Domain d1atnd_: 1atn D: [41793]
    Other proteins in same PDB: d1atna1, d1atna2

Details for d1atnd_

PDB Entry: 1atn (more details), 2.8 Å

PDB Description: atomic structure of the actin:dnase i complex

SCOP Domain Sequences for d1atnd_:

Sequence, based on SEQRES records: (download)

>d1atnd_ d.151.1.1 (D:) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcgncgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Sequence, based on observed residues (ATOM records): (download)

>d1atnd_ d.151.1.1 (D:) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgccgndsfsrepavvkfsshs
tkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqws
sirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaaygls
nemalaisdhypvevtlt

SCOP Domain Coordinates for d1atnd_:

Click to download the PDB-style file with coordinates for d1atnd_.
(The format of our PDB-style files is described here.)

Timeline for d1atnd_: