Lineage for d1dnka_ (1dnk A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419845Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 419846Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 419847Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 419848Protein Deoxyribonuclease I [56225] (1 species)
  7. 419849Species Cow (Bos taurus) [TaxId:9913] [56226] (4 PDB entries)
  8. 419852Domain d1dnka_: 1dnk A: [41792]
    protein/DNA complex; complexed with nag

Details for d1dnka_

PDB Entry: 1dnk (more details), 2.3 Å

PDB Description: the x-ray structure of the dnase i-d(ggtatacc)2 complex at 2.3 angstroms resolution

SCOP Domain Sequences for d1dnka_:

Sequence, based on SEQRES records: (download)

>d1dnka_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Sequence, based on observed residues (ATOM records): (download)

>d1dnka_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqysfsrepavvkfsshstkvkefai
valhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqwssirlrtss
tfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayglsnemalais
dhypvevtlt

SCOP Domain Coordinates for d1dnka_:

Click to download the PDB-style file with coordinates for d1dnka_.
(The format of our PDB-style files is described here.)

Timeline for d1dnka_: