Lineage for d3dni__ (3dni -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263297Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 263298Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 263299Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 263300Protein Deoxyribonuclease I [56225] (1 species)
  7. 263301Species Cow (Bos taurus) [TaxId:9913] [56226] (4 PDB entries)
  8. 263303Domain d3dni__: 3dni - [41791]
    complexed with ca, man, nag

Details for d3dni__

PDB Entry: 3dni (more details), 2 Å

PDB Description: crystallographic refinement and structure of dnase i at 2 angstroms resolution

SCOP Domain Sequences for d3dni__:

Sequence, based on SEQRES records: (download)

>d3dni__ d.151.1.1 (-) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Sequence, based on observed residues (ATOM records): (download)

>d3dni__ d.151.1.1 (-) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgccgndsfsrepavvkfsshs
tkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqws
sirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaaygls
nemalaisdhypvevtlt

SCOP Domain Coordinates for d3dni__:

Click to download the PDB-style file with coordinates for d3dni__.
(The format of our PDB-style files is described here.)

Timeline for d3dni__: