Lineage for d3dnia_ (3dni A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988149Protein Deoxyribonuclease I [56225] (1 species)
  7. 2988150Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. 2988157Domain d3dnia_: 3dni A: [41791]
    complexed with ca

Details for d3dnia_

PDB Entry: 3dni (more details), 2 Å

PDB Description: crystallographic refinement and structure of dnase i at 2 angstroms resolution
PDB Compounds: (A:) deoxyribonuclease I

SCOPe Domain Sequences for d3dnia_:

Sequence, based on SEQRES records: (download)

>d3dnia_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Sequence, based on observed residues (ATOM records): (download)

>d3dnia_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgccgndsfsrepavvkfsshs
tkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqws
sirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaaygls
nemalaisdhypvevtlt

SCOPe Domain Coordinates for d3dnia_:

Click to download the PDB-style file with coordinates for d3dnia_.
(The format of our PDB-style files is described here.)

Timeline for d3dnia_: