![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
![]() | Domain d7d5wp_: 7d5w P: [417902] Other proteins in same PDB: d7d5wa_, d7d5wb1, d7d5wb2, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_ automated match to d3ag3c_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn |
PDB Entry: 7d5w (more details), 1.84 Å
SCOPe Domain Sequences for d7d5wp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d5wp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d7d5wp_:
![]() Domains from other chains: (mouse over for more information) d7d5wa_, d7d5wb1, d7d5wb2, d7d5wc_, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_ |