Lineage for d7d5wo2 (7d5w O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771099Domain d7d5wo2: 7d5w O:91-227 [417901]
    Other proteins in same PDB: d7d5wa_, d7d5wb1, d7d5wc_, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wp_, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_
    automated match to d1occb1
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7d5wo2

PDB Entry: 7d5w (more details), 1.84 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of o at 1.84 angstrom resolution
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d7d5wo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d5wo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d7d5wo2:

Click to download the PDB-style file with coordinates for d7d5wo2.
(The format of our PDB-style files is described here.)

Timeline for d7d5wo2:

  • d7d5wo2 is new in SCOPe 2.08-stable