Lineage for d2dnja_ (2dnj A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36561Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 36562Superfamily d.151.1: DNase I-like [56219] (1 family) (S)
  5. 36563Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 36564Protein Deoxyribonuclease I [56225] (1 species)
  7. 36565Species Cow (Bos taurus) [TaxId:9913] [56226] (4 PDB entries)
  8. 36566Domain d2dnja_: 2dnj A: [41790]

Details for d2dnja_

PDB Entry: 2dnj (more details), 2 Å

PDB Description: dnase i-induced dna conformation. 2 angstroms structure of a dnase i- octamer complex

SCOP Domain Sequences for d2dnja_:

Sequence, based on SEQRES records: (download)

>d2dnja_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Sequence, based on observed residues (ATOM records): (download)

>d2dnja_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus)}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqydddsfsrepavvkfsshstkvke
faivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqwssirlr
tsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayglsnemal
aisdhypvevtlt

SCOP Domain Coordinates for d2dnja_:

Click to download the PDB-style file with coordinates for d2dnja_.
(The format of our PDB-style files is described here.)

Timeline for d2dnja_: