Lineage for d2dnja_ (2dnj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988149Protein Deoxyribonuclease I [56225] (1 species)
  7. 2988150Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. 2988155Domain d2dnja_: 2dnj A: [41790]
    protein/DNA complex; complexed with nag

Details for d2dnja_

PDB Entry: 2dnj (more details), 2 Å

PDB Description: dnase i-induced dna conformation. 2 angstroms structure of a dnase i- octamer complex
PDB Compounds: (A:) deoxyribonuclease I

SCOPe Domain Sequences for d2dnja_:

Sequence, based on SEQRES records: (download)

>d2dnja_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Sequence, based on observed residues (ATOM records): (download)

>d2dnja_ d.151.1.1 (A:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqydddsfsrepavvkfsshstkvke
faivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqwssirlr
tsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayglsnemal
aisdhypvevtlt

SCOPe Domain Coordinates for d2dnja_:

Click to download the PDB-style file with coordinates for d2dnja_.
(The format of our PDB-style files is described here.)

Timeline for d2dnja_: