Lineage for d1dewb_ (1dew B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735708Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 735729Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 735730Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)
  8. 735736Domain d1dewb_: 1dew B: [41787]

Details for d1dewb_

PDB Entry: 1dew (more details), 2.65 Å

PDB Description: crystal structure of human ape1 bound to abasic dna
PDB Compounds: (B:) major apurinic/apyrimidinic endonuclease

SCOP Domain Sequences for d1dewb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dewb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
wrldyfllshsllpalcdskirskalgsdhcpitlylal

SCOP Domain Coordinates for d1dewb_:

Click to download the PDB-style file with coordinates for d1dewb_.
(The format of our PDB-style files is described here.)

Timeline for d1dewb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dewa_