Lineage for d7cp5t_ (7cp5 T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024960Domain d7cp5t_: 7cp5 T: [417857]
    Other proteins in same PDB: d7cp5a_, d7cp5b1, d7cp5b2, d7cp5c_, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5k_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5o2, d7cp5p_, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5x_, d7cp5y_, d7cp5z_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7cp5t_

PDB Entry: 7cp5 (more details), 1.76 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of e at 1.76 angstrom resolution
PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d7cp5t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cp5t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d7cp5t_:

Click to download the PDB-style file with coordinates for d7cp5t_.
(The format of our PDB-style files is described here.)

Timeline for d7cp5t_:

  • d7cp5t_ is new in SCOPe 2.08-stable