Lineage for d7cp5p_ (7cp5 P:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027166Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 3027167Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)
  8. 3027217Domain d7cp5p_: 7cp5 P: [417853]
    Other proteins in same PDB: d7cp5a_, d7cp5b1, d7cp5b2, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5g_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5k_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5o2, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5t_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5x_, d7cp5y_, d7cp5z_
    automated match to d3ag3c_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7cp5p_

PDB Entry: 7cp5 (more details), 1.76 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of e at 1.76 angstrom resolution
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7cp5p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cp5p_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d7cp5p_:

Click to download the PDB-style file with coordinates for d7cp5p_.
(The format of our PDB-style files is described here.)

Timeline for d7cp5p_:

  • d7cp5p_ is new in SCOPe 2.08-stable