Lineage for d1de9b_ (1de9 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84756Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 84757Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 84758Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 84765Protein DNA repair endonuclease Hap1 [56223] (1 species)
  7. 84766Species Human (Homo sapiens) [TaxId:9606] [56224] (6 PDB entries)
  8. 84772Domain d1de9b_: 1de9 B: [41785]

Details for d1de9b_

PDB Entry: 1de9 (more details), 3 Å

PDB Description: human ape1 endonuclease with bound abasic dna and mn2+ ion

SCOP Domain Sequences for d1de9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de9b_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens)}
alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOP Domain Coordinates for d1de9b_:

Click to download the PDB-style file with coordinates for d1de9b_.
(The format of our PDB-style files is described here.)

Timeline for d1de9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1de9a_