Lineage for d1de9a_ (1de9 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676255Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1676278Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 1676279Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)
  8. 1676292Domain d1de9a_: 1de9 A: [41784]
    protein/DNA complex; complexed with mn

Details for d1de9a_

PDB Entry: 1de9 (more details), 3 Å

PDB Description: human ape1 endonuclease with bound abasic dna and mn2+ ion
PDB Compounds: (A:) major apurinic/apyrimidinic endonuclease

SCOPe Domain Sequences for d1de9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de9a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d1de9a_:

Click to download the PDB-style file with coordinates for d1de9a_.
(The format of our PDB-style files is described here.)

Timeline for d1de9a_: