Lineage for d1de9a_ (1de9 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612660Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 612661Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 612662Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 612672Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 612673Species Human (Homo sapiens) [TaxId:9606] [56224] (6 PDB entries)
  8. 612680Domain d1de9a_: 1de9 A: [41784]

Details for d1de9a_

PDB Entry: 1de9 (more details), 3 Å

PDB Description: human ape1 endonuclease with bound abasic dna and mn2+ ion

SCOP Domain Sequences for d1de9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de9a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens)}
alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOP Domain Coordinates for d1de9a_:

Click to download the PDB-style file with coordinates for d1de9a_.
(The format of our PDB-style files is described here.)

Timeline for d1de9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1de9b_