Lineage for d1e9nb_ (1e9n B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548551Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2548574Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 2548575Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)
  8. 2548588Domain d1e9nb_: 1e9n B: [41783]
    complexed with pb

Details for d1e9nb_

PDB Entry: 1e9n (more details), 2.2 Å

PDB Description: a second divalent metal ion in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, ape1, and its implications for the catalytic mechanism
PDB Compounds: (B:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d1e9nb_:

Sequence, based on SEQRES records: (download)

>d1e9nb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d1e9nb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivaefds
fvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpk
gnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldy
fllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d1e9nb_:

Click to download the PDB-style file with coordinates for d1e9nb_.
(The format of our PDB-style files is described here.)

Timeline for d1e9nb_: