![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.1: DNase I-like [56220] (7 proteins) |
![]() | Protein DNA repair endonuclease Hap1 [56223] (1 species) Major apurinic/apyrimidinic endonuclease APE1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries) |
![]() | Domain d1e9nb_: 1e9n B: [41783] complexed with pb |
PDB Entry: 1e9n (more details), 2.2 Å
SCOPe Domain Sequences for d1e9nb_:
Sequence, based on SEQRES records: (download)
>d1e9nb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl dyfllshsllpalcdskirskalgsdhcpitlylal
>d1e9nb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen klpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivaefds fvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpk gnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldy fllshsllpalcdskirskalgsdhcpitlylal
Timeline for d1e9nb_: