Lineage for d1e9na_ (1e9n A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84756Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 84757Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 84758Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 84765Protein DNA repair endonuclease Hap1 [56223] (1 species)
  7. 84766Species Human (Homo sapiens) [TaxId:9606] [56224] (6 PDB entries)
  8. 84769Domain d1e9na_: 1e9n A: [41782]

Details for d1e9na_

PDB Entry: 1e9n (more details), 2.2 Å

PDB Description: a second divalent metal ion in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, ape1, and its implications for the catalytic mechanism

SCOP Domain Sequences for d1e9na_:

Sequence, based on SEQRES records: (download)

>d1e9na_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens)}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d1e9na_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens)}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivaefds
fvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpk
gnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldy
fllshsllpalcdskirskalgsdhcpitlylal

SCOP Domain Coordinates for d1e9na_:

Click to download the PDB-style file with coordinates for d1e9na_.
(The format of our PDB-style files is described here.)

Timeline for d1e9na_: