Lineage for d1e9na_ (1e9n A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)
  8. Domain d1e9na_: 1e9n A: [41782]
    complexed with pb

Details for d1e9na_

PDB Entry: 1e9n (more details), 2.2 Å

PDB Description: a second divalent metal ion in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, ape1, and its implications for the catalytic mechanism
PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d1e9na_:

Sequence, based on SEQRES records: (download)

>d1e9na_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d1e9na_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvivaefds
fvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpk
gnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldy
fllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d1e9na_ are not available.

Timeline for d1e9na_:

Domains from other chains:
(mouse over for more information)
d1e9nb_