SCOPe 2.08: Domain d7clla1: 7cll A:1-139

Lineage for d7clla1 (7cll A:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [395129] (3 PDB entries)

8. Domain d7clla1: 7cll A:1-139 [417814]
   Other proteins in same PDB: d7clla2, d7cllb2, d7cllc2, d7clld2
   automated match to d6l7da1
   complexed with 2pg, act, cl, gol, mg, peg

Details for d7clla1

PDB Entry: 7cll, 1.99 Å

PDB Description: mycobacterium tubeculosis enolase in complex with 2-phosphoglycerate

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d7clla1:

Sequence; same for both SEQRES and ATOM records:

>d7clla1 d.54.1.0 (A:1-139) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpiieqvrareildsrgnptvevevalidgtfaraavpsgastgeheavelrdggdrygg
kgvqkavqavldeigpaviglnaddqrlvdqalvdldgtpdksrlggnailgvslavaka
aadsaelplfryvggpnah

Timeline for d7clla1:

• d7clla1 is new in SCOPe 2.08-stable