SCOP 1.75: Domain d1bixa_: 1bix A:

Lineage for d1bixa_ (1bix A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (3 families)

5. Family d.151.1.1: DNase I-like [56220] (6 proteins)

6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
   Major apurinic/apyrimidinic endonuclease APE1

7. Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)

8. Domain d1bixa_: 1bix A: [41781]
   complexed with pt, sm

Details for d1bixa_

PDB Entry: 1bix, 2.2 Å

PDB Description: the crystal structure of the human dna repair endonuclease hap1 suggests the recognition of extra-helical deoxyribose at dna abasic sites

PDB Compounds: (A:) ap endonuclease 1

SCOP Domain Sequences for d1bixa_:

Sequence; same for both SEQRES and ATOM records:

>d1bixa_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d1bixa_:

• d1bixa_ first appeared (with stable ids) in SCOP 1.55, called d1bix__
  
• d1bixa_ appears in SCOP 1.73
  
• d1bixa_ appears in SCOPe 2.01
  
• d1bixa_ appears in the current release, SCOPe 2.08