![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d7cj2l_: 7cj2 L: [417791] Other proteins in same PDB: d7cj2a1, d7cj2a2, d7cj2b1, d7cj2b2, d7cj2c_, d7cj2k_ automated match to d6shgl_ complexed with bma, nag |
PDB Entry: 7cj2 (more details), 2.7 Å
SCOPe Domain Sequences for d7cj2l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cj2l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqtisswlnwyqqkpgkapklliyaasrlqsgvps rfsgsgsgtdftltisslqpedfatyycqqsystpltfgqgtkveikastvaapsvfifp psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl tlskadyekhkvyacevthqglsspvtk
Timeline for d7cj2l_: