Lineage for d7cj2l_ (7cj2 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757396Domain d7cj2l_: 7cj2 L: [417791]
    Other proteins in same PDB: d7cj2a1, d7cj2a2, d7cj2b1, d7cj2b2, d7cj2c_, d7cj2k_
    automated match to d6shgl_
    complexed with bma, nag

Details for d7cj2l_

PDB Entry: 7cj2 (more details), 2.7 Å

PDB Description: crystal structure of the fab antibody complexed with human ykl-40
PDB Compounds: (L:) Fab(Light chain)

SCOPe Domain Sequences for d7cj2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cj2l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqtisswlnwyqqkpgkapklliyaasrlqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystpltfgqgtkveikastvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtk

SCOPe Domain Coordinates for d7cj2l_:

Click to download the PDB-style file with coordinates for d7cj2l_.
(The format of our PDB-style files is described here.)

Timeline for d7cj2l_:

  • d7cj2l_ is new in SCOPe 2.08-stable