Lineage for d1ako__ (1ako -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84756Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 84757Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 84758Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. 84777Protein DNA-repair enzyme exonuclease III [56221] (1 species)
  7. 84778Species Escherichia coli [TaxId:562] [56222] (1 PDB entry)
  8. 84779Domain d1ako__: 1ako - [41779]

Details for d1ako__

PDB Entry: 1ako (more details), 1.7 Å

PDB Description: exonuclease iii from escherichia coli

SCOP Domain Sequences for d1ako__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ako__ d.151.1.1 (-) DNA-repair enzyme exonuclease III {Escherichia coli}
mkfvsfninglrarphqleaivekhqpdviglqetkvhddmfpleevaklgynvfyhgqk
ghygvalltketpiavrrgfpgddeeaqrriimaeipsllgnvtvingyfpqgesrdhpi
kfpakaqfyqnlqnyletelkrdnpvlimgdmnisptdldigigeenrkrwlrtgkcsfl
peerewmdrlmswglvdtfrhanpqtadrfswfdyrskgfddnrglridlllasqplaec
cvetgidyeirsmekpsdhapvwatfrr

SCOP Domain Coordinates for d1ako__:

Click to download the PDB-style file with coordinates for d1ako__.
(The format of our PDB-style files is described here.)

Timeline for d1ako__: