Lineage for d1ako__ (1ako -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.151: DNase I-like [56218] (1 superfamily) Superfamily d.151.1: DNase I-like [56219] (1 family) 
Family d.151.1.1: DNase I-like [56220] (3 proteins) Protein DNA-repair enzyme exonuclease III [56221] (1 species) Species Escherichia coli [TaxId:562] [56222] (1 PDB entry) 
Domain d1ako__: 1ako - [41779]
Details for d1ako__
PDB Entry: 1ako (more details), 1.7 Å
PDB Description: exonuclease iii from escherichia coli
SCOP Domain Sequences for d1ako__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ako__ d.151.1.1 (-) DNA-repair enzyme exonuclease III {Escherichia coli}
mkfvsfninglrarphqleaivekhqpdviglqetkvhddmfpleevaklgynvfyhgqk
ghygvalltketpiavrrgfpgddeeaqrriimaeipsllgnvtvingyfpqgesrdhpi
kfpakaqfyqnlqnyletelkrdnpvlimgdmnisptdldigigeenrkrwlrtgkcsfl
peerewmdrlmswglvdtfrhanpqtadrfswfdyrskgfddnrglridlllasqplaec
cvetgidyeirsmekpsdhapvwatfrr
SCOP Domain Coordinates for d1ako__:
Click to download the PDB-style file with coordinates for d1ako__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ako__:
- d1ako__ appears in SCOP 1.57
- d1ako__ appears in the current release, SCOPe 2.08, called d1akoa_
View in 3D