Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d7cj2c_: 7cj2 C: [417788] Other proteins in same PDB: d7cj2a1, d7cj2a2, d7cj2b1, d7cj2b2, d7cj2d_, d7cj2l_ automated match to d6shgh_ complexed with bma, nag |
PDB Entry: 7cj2 (more details), 2.7 Å
SCOPe Domain Sequences for d7cj2c_:
Sequence, based on SEQRES records: (download)
>d7cj2c_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftfsnyamswvrqapgkglewvsgisgsggttyy adsvkgrftisrdnskntlylqmnslraedtavyycagvgtfdvwgqgtlvtvssastak gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys lssvvtvpssslgtqtyicnvnhkpsntkvdkkv
>d7cj2c_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftfsnyamswvrqapgkglewvsgisgsggttyy adsvkgrftisrdnskntlylqmnslraedtavyycagvgtfdvwgqgtlvtvssastak gpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv pssslgyicnvnhkpsntkvdkkv
Timeline for d7cj2c_: