SCOPe 2.08: Domain d7cj2b2: 7cj2 B:240-307

Lineage for d7cj2b2 (7cj2 B:240-307)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries)

8. Domain d7cj2b2: 7cj2 B:240-307 [417787]
   Other proteins in same PDB: d7cj2a1, d7cj2b1, d7cj2c_, d7cj2d_, d7cj2k_, d7cj2l_
   automated match to d1hjva2
   complexed with bma, nag

Details for d7cj2b2

PDB Entry: 7cj2, 2.7 Å

PDB Description: crystal structure of the fab antibody complexed with human ykl-40

PDB Compounds: (B:) Chitinase 3-like 1 (Cartilage glycoprotein-39), isoform CRA_a

SCOPe Domain Sequences for d7cj2b2:

Sequence; same for both SEQRES and ATOM records:

>d7cj2b2 d.26.3.1 (B:240-307) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

Timeline for d7cj2b2:

• d7cj2b2 is new in SCOPe 2.08-stable