![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries) |
![]() | Domain d7cj2b2: 7cj2 B:240-307 [417787] Other proteins in same PDB: d7cj2a1, d7cj2b1, d7cj2c_, d7cj2d_, d7cj2k_, d7cj2l_ automated match to d1hjva2 complexed with bma, nag |
PDB Entry: 7cj2 (more details), 2.7 Å
SCOPe Domain Sequences for d7cj2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cj2b2 d.26.3.1 (B:240-307) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]} fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat kgnqwvgy
Timeline for d7cj2b2: