Lineage for d7cj2b1 (7cj2 B:1-239,B:308-361)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831805Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 2831806Species Human (Homo sapiens) [TaxId:9606] [89483] (8 PDB entries)
  8. 2831830Domain d7cj2b1: 7cj2 B:1-239,B:308-361 [417786]
    Other proteins in same PDB: d7cj2a2, d7cj2b2, d7cj2c_, d7cj2d_, d7cj2k_, d7cj2l_
    automated match to d1hjva1
    complexed with bma, nag

Details for d7cj2b1

PDB Entry: 7cj2 (more details), 2.7 Å

PDB Description: crystal structure of the fab antibody complexed with human ykl-40
PDB Compounds: (B:) Chitinase 3-like 1 (Cartilage glycoprotein-39), isoform CRA_a

SCOPe Domain Sequences for d7cj2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cj2b1 c.1.8.5 (B:1-239,B:308-361) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaa

SCOPe Domain Coordinates for d7cj2b1:

Click to download the PDB-style file with coordinates for d7cj2b1.
(The format of our PDB-style files is described here.)

Timeline for d7cj2b1:

  • d7cj2b1 is new in SCOPe 2.08-stable