Lineage for d7cj2a2 (7cj2 A:240-307)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941963Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 2941964Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries)
  8. 2941987Domain d7cj2a2: 7cj2 A:240-307 [417785]
    Other proteins in same PDB: d7cj2a1, d7cj2b1, d7cj2c_, d7cj2d_, d7cj2k_, d7cj2l_
    automated match to d1hjva2
    complexed with bma, nag

Details for d7cj2a2

PDB Entry: 7cj2 (more details), 2.7 Å

PDB Description: crystal structure of the fab antibody complexed with human ykl-40
PDB Compounds: (A:) Chitinase 3-like 1 (Cartilage glycoprotein-39), isoform CRA_a

SCOPe Domain Sequences for d7cj2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cj2a2 d.26.3.1 (A:240-307) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOPe Domain Coordinates for d7cj2a2:

Click to download the PDB-style file with coordinates for d7cj2a2.
(The format of our PDB-style files is described here.)

Timeline for d7cj2a2:

  • d7cj2a2 is new in SCOPe 2.08-stable