Lineage for d7ci0d_ (7ci0 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902106Species Erythrobacter longus [TaxId:1044] [388858] (7 PDB entries)
  8. 2902110Domain d7ci0d_: 7ci0 D: [417775]
    automated match to d6kf1d_
    complexed with 6na, dio, dms, edo, gol, mes, na, npo, peg, pge, so4; mutant

Details for d7ci0d_

PDB Entry: 7ci0 (more details), 1.7 Å

PDB Description: microbial hormone-sensitive lipase e53 mutant s162a
PDB Compounds: (D:) Lipase

SCOPe Domain Sequences for d7ci0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ci0d_ c.69.1.0 (D:) automated matches {Erythrobacter longus [TaxId: 1044]}
tpfirpdmkafleaiaamagptlaemtleearasyvalhgmadrparelavirnlscpgp
agdiplrlydaresreagpvitfyhgggfvigdldthhnlcteiaalmdlpvvavdyrla
pehpfpaaiedceaatrwvasspselgrtasgvipigdaaggnativvsqllgakpadvp
vvlqvpifplasdavgsasleafaegfvltkasieffdtaykadradprgfpilgdhtaa
pptivatasldpirdsgrdyakalveagrdvvylemegvthsftniraavpstqgdleri
iaamkmmlg

SCOPe Domain Coordinates for d7ci0d_:

Click to download the PDB-style file with coordinates for d7ci0d_.
(The format of our PDB-style files is described here.)

Timeline for d7ci0d_:

  • d7ci0d_ is new in SCOPe 2.08-stable